PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G05220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 187aa    MW: 21495 Da    PI: 10.3461
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G05220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.13.6e-261058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr gilKKA ELSvLCda+v viifss+gkl+e +
  LPERR12G05220.1 10 RIENPVHRQVTFCKRRGGILKKARELSVLCDADVGVIIFSSQGKLHELA 58
                     8*********************************************965 PP

2K-box35.34.8e-131071822298
            K-box  22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      + Lk+    + r+ R   G + ++++l  L++Le+ Le    +iR+kK++++ ++i+ l++ke  ++ +n++L++k 
  LPERR12G05220.1 107 SYLKNFEVIMNRS-RSAYGGGAGEMTLDKLHELEKGLELWSYQIRTKKMQMMQQEIQFLRNKEGIMKAANEMLQEKA 182
                      4555554555555.************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.92E-28175IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.394161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-36160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002652.70E-36373No hitNo description
PRINTSPR004041.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.95485187IPR002487Transcription factor, K-box
PfamPF014864.4E-14111181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRQVT FCKRRGGILK KARELSVLCD ADVGVIIFSS QGKLHELATN  60
GNMHNLVQRY QSNVEGNQME RGALQRQVTE GVFLLREEIG LLQRGLSYLK NFEVIMNRSR  120
SAYGGGAGEM TLDKLHELEK GLELWSYQIR TKKMQMMQQE IQFLRNKEGI MKAANEMLQE  180
KASVQLQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1777001e-111AY177700.1 Oryza sativa (japonica cultivar-group) transcription factor MADS33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618440.11e-103PREDICTED: MADS-box transcription factor 33
SwissprotQ2QW551e-104MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0D9XXS41e-135A0A0D9XXS4_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036463-PA1e-104(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-53AGAMOUS-like 12